Markdown Formatting

Markdown is a plain text format for writing structured documents. We use markdown-it to parse markdown content which follows commonMark specifications.

For common markdown syntax please refer to this reference sheet. The following content are mainly focused on more advanced features and/or features specific to ERMrestJS.

Table of Contents

  • Inline Vs. Block

  • Attributes

  • Examples

    • 1. Link (Anchor)

    • 2. Download Button

    • 3. Image

      • 3.1. Image with static width and height

      • 3.2. Image with maximum width and maximum height

      • 3.3. Preserving the aspect ratio of image

    • 4. Thumbnail With Link To Original Image And A caption

    • 5. Image with zoom capabilties

    • 6. Iframe

      • a. Styling the Iframe

      • a.1. Without any attributes

      • a.2. With height and width defined

      • a.3. Invalid link

      • a.4. Iframe without scrolling

      • a.5. Class and style attached to the iframe element

      • a.6. Iframe with figure class and style

      • a.7. Iframe with caption styles and figure styles

      • b. Captions

      • b.1. Linkable caption

      • b.2. Download link caption

      • b.3. Caption positioned at the bottom

      • b.4. Caption class and style

      • b.5. Linkable caption open new tab

      • c. Responsiveness and Other Cases

      • c.1. Stretch to height and width of parent container

      • c.2. Fill container with min-width

      • c.3. Fill container with min-width and min-height and max-height

      • c.4. Iframe with set height and responsive width

      • c.5. Iframe with variable height based on viewport with bounds

      • c.6. Iframe with fullscreen button hidden

      • c.7. Iframe with fullscreen button open new tab

    • 7. Dropdown download button

    • 8. Vocabulary

    • 9. Youtube Video

    • 10. Video

    • 11. Subscript

    • 12. Superscript

    • 13. Span (Attach Attributes To Text)

    • 14. Escape markdown content

    • 15. RID link

    • 16. Table

    • 17. Gene Sequence

    • 18. Div (Custom container)

    • 19. File Preview

Inline Vs. Block

In HTML we have block and inline elements. Block elements usually add a newline and extra spaces around the content, while inline elements will only take up as much width as is needed to display the content. Paragraphs <p>, headers <h#>, and division <div> are some of the common block elements. Span <span>, images <img>, and anchors <a> are examples for inline blocks.

This concept exists in ERMrestJS markdown parser too. If we parse the content as a block, if the given markdown value does not produce a proper block element, it will be wrapped in a <p> tag. While rendering it inline, will not add the <p> tag. Also newline (\n) is not acceptable in values of inline elements.

[caption](http://example.com)

#inline output
<a href="http://example.com">caption</a>

#block output
<p>
  <a href="http://example.com">caption</a>
</p>

Therefore sometimes we prefer to render the value as inline. ERMrestJS parser also has different set of rules for inline and block. All the inline tags are acceptable while rendering a block, but not the other way around. For example you cannot have a header in inline. So you need to be careful while using the blocks. The following are different places that we are rendering inline. Other parts of code accept block elements.

  • row-name logic. More specifcally the logic for processing row_markdown_pattern.

  • While processing markdown_name (used on facets, columns, tables, and schemas).

Attributes

You can attach attributes to any element in your markdown. Generally you can attach the attributes in {} to your element. For example if you want to add attributes to a link, you can use the [caption](link){attributes} template. You can have any number of attributes and to separate the attributes you just need to have white space between them. The following are some examples of attaching attributes:

  • Attaching multiple attributes:

    **Multiple attributes Example**{.test .cls-2 val=1 disabled}
    
    #OUTPUT
    <p>
      <strong class="test cls-2" val="1" disabled="">Multiple attributes Example</strong>
    </p>
    

    Multiple attributes Example

  • Attaching attributes to markdown table (the two newlines between the end of table and the added attributes are required):

    |header|\n|-|\n|text|\n\n{.class-name}
    
    #OUTPUT
    <table class="class-name">
      <thead>
        <tr>
          <th>heading</th>
        </tr>
      </thead>
      <tbody>
        <tr>
          <td>text</td>
        </tr>
      </tbody>
    </table>
    
    heading
    text

Depending on the markdown element type, different attrbiutes will be acceptable and throughout this document we will mention them. The following are some of the general attributes:

Tooltip

Using data-chaise-tooltip attribute you can add a tooltip to any HTML element.

[tooltip example](http://example.com){data-chaise-tooltip="tooltip for this link"}

By default the tooltip will be displayed at the bottom of the element. We’re also showing the tooltip icon beside the element. If you don’t want this behavior the following is ways to customize this:

  1. You can use the data-chaise-tooltip-placement to change this placement. Accepted values are "top", "right", "bottom", "left". For example,

:span:Caption:/span:{data-chaise-tooltip="tooltip for this link" data-chaise-tooltip-placement="right"}
  1. By adding data-chaise-tooltip-no-icon to your definition we’re not going to add the tooltip icon.

:span:Caption:/span:{data-chaise-tooltip="tooltip for this link" data-chaise-tooltip-no-icon}

Classes

Any attribute that starts with a . will be treated as class name.

[class example](http://example.com){.test}

#OUTPUT
<p>
  <a href="http://example.com" class="test">class example</a>
</p>

Special Classes

The following is the list of special class names that you can use:

  • .chaise-btn: This class is used to represent buttons. You should use it in conjunction with any of the following classes:

    • .chaise-btn-primary

    • .chaise-btn-secondary

    • .chaise-btn-tertiary

  • .download-alt: Used to represent a download button. .download is the old and alternative class for it.

  • .asset-permission: If used on a link element, chaise will validate whether the user can download the asset before a download is attempted.

  • .external-link: By adding this to links, chaise shows a notification to the user when they are being navigated away from chaise for external links and assets hosted elsewhere.

  • .external-link-no-icon: By default we’re going to add a icon to any external links. If you don’t want it in a particular link, you can use this class.

  • .vocab: Used to represent a vocabulary.

  • .chaise-autofill: Used to set the height and width to fill the parent container based on the user’s browser.

  • .fullscreen-off: When applied in iframe template, this class hides the full screen button that appears at the top right corner.

  • .chaise-reduce-header-margin: Used on a <h3> or other header tag to reduce the space after the header to 5px. Link to implementation

  • .chaise-iframe-after: Reduces the margin after the element’s content when an iframe is the next element. This class will reduce the margin and pull the iframe content closer. Link to implementation

  • .chaise-image-preview: When applied to an image, Chaise will properly display a scaled down version of the image to the users. Clicking on the image would allow users to see the fully scaled version of the image. You can find an example here. While the behavior looks like a zoom, by clicking on images with this class, we’re switching between these two modes:

    • The scaled-down version,

      • The height of the image is limited to 50vh. Therefore small images will be displayed fully, while the bigger images will be scaled down to fit the limited size.

      • The width is limited to the available width space on the page.

      • The browser will fit the image in the limited height/width while keeping the image’s aspect ratio. Hence, in an image with a larger height than width, you will see extra white space to the left and right of the image.

    • The zoomed-in version,

      • The height and width of the image are not limited; instead, the limits mentioned above are moved to the image’s container. That’s why we will see scrollbars in larger images, and in smaller images, nothing will change.

      The max height mentioned above can be changed by defining the image-preview-max-height property. Please refer to the example for more information.

  • .chaise-image-fallback: ERMrestJS automatically adds this class to every rendered image (you don’t need to add it yourself). When such an image fails to load, Chaise replaces the browser’s broken-image icon with a fallback image. For same-origin images Chaise also checks why it failed and shows a contextual fallback with an explanatory tooltip: “Login required” (401), “Access denied” (403), or “Image not found” (404); other failures get a generic “image unavailable” fallback.

  • .chaise-image-fallback-disabled: Add this class to a specific image to opt it out of the behavior above, so a broken image is left to the browser’s default rendering. Example: ![alt](some-url){.chaise-image-fallback-disabled}.

  • content classes for positioning:

    • classes for horizontal alignment:

      • .chaise-content-left: Aligns the inner content to the left side of the container this class is attached to

      • .chaise-content-center: Aligns the inner content to the center of the container this class is attached to

      • .chaise-content-right: Aligns the inner content to the right side of the container this class is attached to

    • classes for vertical alignment:

      • .chaise-content-top: Aligns the inner content to the top of the container this class is attached to

      • .chaise-content-middle: Aligns the inner content to the middle of the container this class is attached to

      • .chaise-content-bottom: Aligns the inner content to the bottom of the container this class is attached to

  • .chaise-word-break-all: This enforces the given content to be broken at any character if it’s overflowing. Useful for long an arbitary content.

    • For example you can add this to the asset presentation to ensure better UI in compact contexts: [{{{filename}}}]({{{url}}}){download .chaise-word-break-all}. Make sure to also add a min-width to the column header, otherwise the column might become very narrow.

  • .chaise-gene-sequence-compact: When applied to a Gene Sequence block, it will ensure showing a more compact version. This is recommended for compact contexts.

  • Record status: The following classes can be used to display the record status. The non-compact versions add a background with an appropriate color to the text, while the compact versions display a colored circle to the left of the content:

    • .chaise-record-status-default, .chaise-record-status-info, .chaise-record-status-success, .chaise-record-status-warning, .chaise-record-status-danger

    • .chaise-record-status-compact-default, .chaise-record-status-compact-info , .chaise-record-status-compact-success, .chaise-record-status-compact-warning, .chaise-record-status-compact-danger

You can use the span block to attach these classes to the displayed values. For instance, assuming your “Curation Status” table has a column called name, you could define the following row_name:

{
  "tag:isrd.isi.edu,2016:table-display": {
      "row_name/detailed": {
          "row_markdown_pattern": ":span:{{{name}}}:/span:{ {{#if (eq name 'Under review')}}.chaise-record-status-warning{{else if (eq name 'Reviewed')}}.chaise-record-status-success{{else}}.chaise-record-status-default{{/if}} }"
      },
      "row_name/compact": {
          "row_markdown_pattern": ":span:{{{name}}}:/span:{ {{#if (eq name 'Under review')}}.chaise-record-status-compact-warning{{else if (eq name 'Reviewed')}}.chaise-record-status-compact-success{{else}}.chaise-record-status-compact-default{{/if}} }"
      }
  }
}

Examples

2. Download Button

Download button is a link with some predefined attributes. You can use these attributes to ensure consistent display for the download buttons:

  • download will trigger the browser’s default download behavior and displays the links like the following: download default UI

  • .download-alt will change the link to look like the following: alternative download UI

  • If you would like to create your own download button, we suggest adding a class attribute here and using this class for definining your own CSS rules.

    • Chaise is defining rules based on a[download] selector. You need to ensure that the default CSS rules are overriden and the new ones are added.

  • .asset-permission can be added to validate whether the user can download the asset before a download is attempted.

  • .external-link can be added to show a notification to the user when they are being navigated away from chaise for external links and assets hosted elsewhere.

  • .chaise-word-break-all can be added to download buttons that have a very long filename in compact contexts. It will force the content to be broken into multiple lines. Make sure to also add a min-width to the column header, otherwise the column might become very narrow.

Example:

[Filename](https://code.jquery.com/jquery-3.1.0.js){download .download-alt .asset-permission}

# OUTPUT:
<p>
	<a href="https://code.jquery.com/jquery-3.1.0.js" download="" class="download asset-permission">Jquery Download</a>
</p>

NOTE: please stick to the above formats only to generate a download link.

3. Image

By adding ! at the begining of a link definition, it will display the image. Images are inline elements.

![Image](http://assets.barcroftmedia.com.s3-website-eu-west-1.amazonaws.com/assets/images/recent-images-11.jpg)

# OUTPUT:
<p>
	<img src="http://assets.barcroftmedia.com.s3-website-eu-west-1.amazonaws.com/assets/images/recent-images-11.jpg" alt="Image">
</p>

Image

Just like any other elements, you can define attributes for the Images by defining them in a block after the tag:

![alt text](IMAGE_URL){ <attribute>=<value> }

The following are the most common attributes that you could use:

  • width and height: Useful when you know the width and height of the image, or want to limit the image to certain size.

  • style: Can be used for specifying any styles on the image.

The following are some common examples of styling Images:

3.1. Image with static width and height

You can define the width and height attributes for an image.

![ImageWithSize](http://assets.barcroftmedia.com.s3-website-eu-west-1.amazonaws.com/assets/images/recent-images-11.jpg){width=800 height=300}

# OUTPUT:
<p>
	<img src="http://assets.barcroftmedia.com.s3-website-eu-west-1.amazonaws.com/assets/images/recent-images-11.jpg" alt="ImageWithSize" width="800" height="300">
</p>

ImageWithSize

3.2. Image with maximum width and maximum height

Instead of defining static with and height, you can also define maximum allowed values:

![ImageWithSize](http://assets.barcroftmedia.com.s3-website-eu-west-1.amazonaws.com/assets/images/recent-images-11.jpg){width=500 style="max-height:300px;max-width:800px;"}

# OUTPUT:
<p>
	<img src="http://assets.barcroftmedia.com.s3-website-eu-west-1.amazonaws.com/assets/images/recent-images-11.jpg" alt="ImageWithSize" width="500" style="max-height:300px;max-width:800px;">
</p>

ImageWithSize

3.3. Preserving the aspect ratio of image

To preserve the image’s aspect ratio, you need to add the object-fit:contain style. This is style is helpful in combination with static width or height. For example,

![](https://example.com/path/to/image.png){style=height:500px;object-fit:contain}

With this, the image’s height would be 500px, and object-fit:contain will signal the browser to choose a proper width based on the available space and the image’s aspect ratio.

You can also use this style with both width and height:

![](https://example.com/path/to/image.png){style=height:500px;width:500px;object-fit:contain}

This example specifies the width and height of the image’s container. And depending on the aspect ratio of the image, you will see white space around the scaled-down image (instead of stretching the image to the container’s width/height).

5. Image with zoom capabilties

This is not part of commonMark specification and it will result in a block. You have to follow the syntax completely (notice the newline in the closing tag).

To add zoom capabilities, you just need to add the figure-class=chaise-image-preview attribute:

:::image [](Image-URL){figure-class=chaise-image-preview} \n:::

:::image [](https://example.com/path/to/image.png){figure-class=chaise-image-preview} \n:::

You could customize the maximum height that we should use by defining the image-preview-max-height property like the following:

:::image [](https://example.com/path/to/image.png){figure-class=chaise-image-preview image-preview-max-height="300px"} \n:::

If you’re using this feature in a tabular view, you need to specify the width of the container. Otherwise clicking on the image will expand the image beyond the table’s allowed width. For example:

:::image [](https://example.com/path/to/image.png){figure-class=chaise-image-preview image-preview-max-height="300px" figure-style=width:300px } \n:::

6. Iframe

This is not part of commonMark specification and it will result in a block. You have to follow the syntax completely (notice the newline in the closing tag). The following is the basic syntax structure:

::: iframe [CAPTION](https://example.com) {<attribute>=<value>} \n:::

Below are examples of how to apply height, width, style, and class to the iframe and caption.

a. Styling the Iframe

The following list of terms are used to describe how to style iframes:

  • height and width - used to specify iframe width and iframe height

  • style - the attribute used to attach any standard CSS properties directly to the iframe

    • more commonly used CSS properties for iframes include min-height, min-width, max-height, and max-width

  • class - the attribute used to attach a class to the iframe

    • any self defined class or classes defined as part of chaise are allowed

    • the chaise-autofill class will set the appropriate values for height and width based on the user’s browser

      • CAUTION: using chaise-autofill will ignore the set height or width

    • the fullscreen-off class will hide the fullscreen button

      • NOTE: see example below on how to use this

a.1. Without any attributes

::: iframe [CAPTION](https://example.com) \n:::

# OUTPUT:
<figure class="embed-block">
    <div class="figcaption-wrapper" style="width: 100%;">
        <figcaption class="embed-caption">CAPTION</figcaption>
        <div class="iframe-btn-container">
            <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
        </div>
    </div>
    <iframe src="https://example.com"></iframe>
</figure>

a.2. With height and width defined

::: iframe [CAPTION](https://example.com){width="800" height="300"} \n:::

# OUTPUT:
<figure class="embed-block">
    <div class="figcaption-wrapper" style="width: 800px;">
        <figcaption class="embed-caption">CAPTION</figcaption>
        <div class="iframe-btn-container">
            <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
        </div>
    </div>
    <iframe src="https://example.com" width="800" height="300" ></iframe>
</figure>

a.4. Iframe without scrolling

::: iframe [CAPTION](https://example.com){width="800" height="300" scrolling="no"} \n:::

# OUTPUT:
<figure class="embed-block">
    <div class="figcaption-wrapper" style="width: 800px;">
        <figcaption class="embed-caption">CAPTION</figcaption>
        <div class="iframe-btn-container">
            <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
        </div>
    </div>
    <iframe src="https://example.com" width="800" height="300" scrolling="no"></iframe>
</figure>

a.5. Class and style attached to the iframe element

::: iframe [CAPTION](https://example.com){pos="bottom" style="border: 5px solid;" class="iframe-element-class"} \n:::

# OUTPUT:
<figure class="embed-block">
    <div class="iframe-btn-container">
        <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
    </div>
    <iframe src="https://example.com" style="border: 5px solid;" class="iframe-element-class"></iframe>
    <figcaption class="embed-caption">CAPTION</figcaption>
</figure>

a.6. Iframe with figure class and style

To style the whole iframe enclosing block (<figure>) you can either specify classes using figure-class or CSS style using figure-style.

  • NOTE: iframe-class and iframe-style are deprecated.

::: iframe [CAPTION](https://example.com){pos="bottom" figure-class="iclass" figure-style="border: 1px solid;" link="https://example.com} \n:::

# OUTPUT:
<figure class="embed-block iclass" style="border: 1px solid;">
    <div class="iframe-btn-container">
        <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
    </div>
    <iframe src="https://example.com"></iframe>
    <figcaption class="embed-caption"><a href="https://example.com">CAPTION</a></figcaption>
</figure>

a.7. Iframe with caption styles and figure styles

::: iframe [CAPTION](https://example.com){pos="bottom" figure-class="iclass" figure-style="border: 1px solid;" caption-class="cclass" caption-style="font-weight: 500;" link="https://example.com} \n:::

# OUTPUT:
<figure class="embed-block iclass" style="border: 1px solid;">
    <div class="iframe-btn-container">
        <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
    </div>
    <iframe src="https://example.com"></iframe>
    <figcaption class="embed-caption cclass" style="font-weight: 500;"><a href="https://example.com">CAPTION</a></figcaption>
</figure>

b. Captions

b.1. Linkable caption

::: iframe [CAPTION](https://example.com){width="800" height="300" caption-link="https://example.com"} \n:::

# OUTPUT:
<figure class="embed-block">
    <div class="figcaption-wrapper" style="width: 800px;">
        <figcaption class="embed-caption"><a href="https://example.com">CAPTION</a></figcaption>
        <div class="iframe-btn-container">
            <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
        </div>
    </div>
    <iframe src="https://example.com" width="800" height="300"></iframe>
</figure>

b.3. Caption positioned at the bottom

::: iframe [CAPTION](https://example.com){width="800" height="300" caption-link="https://example.com" pos="bottom" } \n:::

# OUTPUT:
<figure class="embed-block">
    <div class="iframe-btn-container">
        <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
    </div>
    <iframe src="https://example.com" width="800" height="300"></iframe>
    <figcaption class="embed-caption"><a href="https://example.com">CAPTION</a></figcaption>
</figure>

b.4. Caption class and style

To style the caption of an iframe you can either specify classes using caption-class or CSS style using caption-style.

::: iframe [CAPTION](https://example.com){pos="bottom" caption-class="cclass" caption-style="font-weight: 500;" caption-link="https://example.com} \n:::

# OUTPUT:
<figure class="embed-block">
    <div class="iframe-btn-container">
        <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
    </div>
    <iframe src="https://example.com"></iframe>
    <figcaption class="embed-caption cclass" style="font-weight: 500;"><a href="https://example.com">CAPTION</a></figcaption>
</figure>

b.5. Linkable caption open new tab

To have the caption open in a new tab, use caption-target=_blank.

::: iframe [CAPTION](https://example.com){width="800" height="300" caption-link="https://example.com" caption-target="_blank"} \n:::

# OUTPUT:
<figure class="embed-block">
    <div class="figcaption-wrapper" style="width: 800px;">
        <figcaption class="embed-caption"><a href="https://example.com" target="_blank">CAPTION</a></figcaption>
        <div class="iframe-btn-container">
            <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
        </div>
    </div>
    <iframe src="https://example.com" width="800" height="300"></iframe>
</figure>

c. Responsiveness and Other Cases

Some best practices for creating responsive or specifically sized iframes are as follows:

  • For fixed iframe dimensions use height and width.

  • Responsive iframe dimensions:

    • To expand the iframe width to browser width, attach the chaise-autofill class and define min-width on the iframe as part of the style.

      • If browser width is less than the cell’s width (or max width), a scrollbar will be present in the cell itself to scroll left/right to see the rest of the content.

    • To expand the iframe height to the cell height, attach the chaise-autofill class.

      • Specify min-height to initialize the iframe height with the min height value without removing the responsiveness from chaise-autofill

      • Defining max-height on the iframe will limit the responsiveness from continually stretching the iframe

  • Other cases:

    • For iframes that are accompanied by a potentially long caption, define min-height on the iframe to ensure the cell resizes to fit all of the caption and the iframe.

    • CSS styles can be applied to the <td> element with id="entity-<column_name>" to set height/width for the cell

c.1. Stretch to height and width of parent container

If parent container (cell in record app) has no styles, the iframe will only fill the minimum height of the cell

::: iframe [CAPTION](https://example.com){class=chaise-autofill} \n:::

# OUTPUT:
<figure class="embed-block">
    <div class="figcaption-wrapper" style="width: 100%;">
        <figcaption class="embed-caption">CAPTION</figcaption>
        <div class="iframe-btn-container">
            <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
        </div>
    </div>
    <iframe src="https://example.com" class="chaise-autofill"></iframe>
</figure>

c.2. Fill container with min-width

When a min-width value is defined, the parent container will stop resizing once the viewport width forces the container to be smaller than the iframe.

::: iframe [CAPTION](https://example.com){class=chaise-autofill style="min-width: 500px;"} \n:::

# OUTPUT:
<figure class="embed-block">
    <div class="figcaption-wrapper" style="width: 100%;">
        <figcaption class="embed-caption">CAPTION</figcaption>
        <div class="iframe-btn-container">
            <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
        </div>
    </div>
    <iframe src="https://example.com" class="chaise-autofill" style="min-width: 500px;"></iframe>
</figure>

c.3. Fill container with min-width and min-height and max-height

When a min-height value is defined, the parent container will resize to allow for the defined minimum height. Max height is defined to limit the iframe from continually stretching as noted in the best practices above.

::: iframe [CAPTION](https://example.com){class=chaise-autofill style="min-width: 500px; min-height: 400px; max-height: 800px;"} \n:::

# OUTPUT:
<figure class="embed-block">
    <div class="figcaption-wrapper" style="width: 100%;">
        <figcaption class="embed-caption">CAPTION</figcaption>
        <div class="iframe-btn-container">
            <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
        </div>
    </div>
    <iframe src="https://example.com" class="chaise-autofill" style="min-width: 500px; min-height: 400px; max-height: 800px;"></iframe>
</figure>

c.4. Iframe with set height and responsive width

To have a responsive width and a set height, do not use chaise-autofill and set height or min-height with width: 100%.

::: iframe [CAPTION](https://example.com){width=100% style="min-width: 300px; min-height: 400px;"} \n:::

# OUTPUT:
<figure class="embed-block">
    <div class="figcaption-wrapper" style="width: 100%;">
        <figcaption class="embed-caption">CAPTION</figcaption>
        <div class="iframe-btn-container">
            <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
        </div>
    </div>
    <iframe src="https://example.com" width=100% style="min-width: 300px; min-height: 400px;"></iframe>
</figure>

c.5. Iframe with variable height based on viewport with bounds

To create an iframe that responds to the current viewport size, set the height using vh units.

::: iframe [CAPTION](https://example.com){style="min-height: 400px; height: 75vh; max-height: 900px;"} \n:::

# OUTPUT:
<figure class="embed-block">
    <div class="figcaption-wrapper" style="width: 100%;">
        <figcaption class="embed-caption">CAPTION</figcaption>
        <div class="iframe-btn-container">
            <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
        </div>
    </div>
    <iframe src="https://example.com" style="min-height: 400px; height: 75vh; max-height: 900px;"></iframe>
</figure>

c.6. Iframe with fullscreen button hidden

To hide the fullscreen button, use the fullscreen-off class attached to the figure.

::: iframe [CAPTION](https://example.com){width=100% class="chaise-autofill" figure-class="fullscreen-off"} \n:::

# OUTPUT:
<figure class="embed-block fullscreen-off">
    <div class="figcaption-wrapper" style="width: 100%;">
        <figcaption class="embed-caption">CAPTION</figcaption>
        <div class="iframe-btn-container">
            <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
        </div>
    </div>
    <iframe src="https://example.com" width=100% class="chaise-autofill"></iframe>
</figure>

c.7. Iframe with fullscreen button open new tab

To have the fullscreen button open in a new tab, use fullscreen-target=_blank.

::: iframe [CAPTION](https://example.com){width=100% class="chaise-autofill" fullscreen-target="_blank"} \n:::

# OUTPUT:
<figure class="embed-block fullscreen-off">
    <div class="figcaption-wrapper" style="width: 100%;">
        <figcaption class="embed-caption">CAPTION</figcaption>
        <div class="iframe-btn-container">
            <a class="chaise-btn chaise-btn-secondary chaise-btn-iframe" href="https://example.com" target="_blank"><span class="chaise-btn-icon fullscreen-icon"></span><span>Full screen</span></a>
        </div>
    </div>
    <iframe src="https://example.com" width=100% class="chaise-autofill"></iframe>
</figure>

8. Vocabulary

To show text as vocabulary, you can use the predefined vocab class. The following markdown pattern turns a bock of text, to a gray bold bubble with color blue.

**some bold term**{.vocab}
# OUTPUT: <strong class="vocab">some bold term</strong>

9. Youtube Video

Assuming that https://www.youtube.com/watch?v=YOUTUBE_VIDEO_ID is the link to a youtube video,

  • Video thumbnail is https://img.youtube.com/vi/YOUTUBE_VIDEO_ID/0.jpg

  • Embed link is https://www.youtube.com/embed/YOUTUBE_VIDEO_ID. You can also pass different query parameters to customize the way the video looks like. Please refer to the Youtube API document for more information.

Therefore you have two options for showing a youtube video in your markdown templates:

  • Use an iframe

::: iframe [Video Caption](https://www.youtube.com/embed/YOUTUBE_VIDEO_ID){width=800 height=300} \n:::

# OUTPUT:
<figure class="embed-block">
	<figcaption class="embed-caption">CAPTION</figcaption>
	<iframe src="https://www.youtube.com/embed/YOUTUBE_VIDEO_ID" width="800" height="300" ></iframe>
</figure>
  • Show the video thumbnail that is linked to the youtube video

[![](https://img.youtube.com/vi/YOUTUBE_VIDEO_ID/0.jpg){width=800 height=300}](https://www.youtube.com/watch?v=YOUTUBE_VIDEO_ID)

# OUTPUT:
<p>
    <a href="https://www.youtube.com/watch?v=YOUTUBE_VIDEO_ID">
        <img src="https://img.youtube.com/vi/YOUTUBE_VIDEO_ID/0.jpg" alt="">
    </a>
</p>

10. Video

This is not part of commonMark specification and it will result in a block. You have to follow the syntax completely (notice the newline in the closing tag).

markdown syntax: '::: video [<caption>](<source>)[{attribute list}] \n:::'

There must be a space before \n:::.

  • caption: The caption provides a short description of the video

  • source: The address to the location of the video

  • attribute list: The attributes supported will be (height, width, preload, loop, muted, autoload, pos)

    • height: Sets the height of the video player

    • width: Sets the width of the video player

    • preload: Specifies if and how the author thinks the video should be loaded when the page loads

    • loop: Specifies that the video will start over again, every time it is finished

    • muted: Specifies that the audio output of the video should be muted

    • pos: Specifies where the caption of video should appear (top or bottom)

Examples

  • Without any attributes

::: video [This is sample video](http://techslides.com/demos/sample-videos/small.mp4)\n:::

# OUTPUT:
<figure>
     <figcaption>This is sample video</figcaption>
     <video controls ><source src="http://techslides.com/demos/sample-videos/small.mp4" type="video/mp4">
     </video>
</figure>
  • With attributes width=400, height=300

::: video [This is sample video](http://techslides.com/demos/sample-videos/small.mp4){width=400 height 300} \n:::

# OUTPUT:
<figure>
    <figcaption>This is sample video</figcaption>
    <video controls width=400 height=300 ><source src="http://techslides.com/demos/sample-videos/small.mp4" type="video/mp4">
    </video>
</figure>"
  • With boolean attributes muted, autoload, loop, preload

::: video [This is sample video](http://techslides.com/demos/sample-videos/small.mp4){autoload muted loop preload} \n:::

# OUTPUT:
<figure>
    <figcaption>This is sample video</figcaption>
    <video controls autoload muted loop preload ><source src="http://techslides.com/demos/sample-videos/small.mp4" type="video/mp4">
    </video>
</figure>
  • To put the video caption at bottom or top, use the pos attribute (bootom or top)

::: video [My Caption](http://techslides.com/demos/sample-videos/small.mp4){pos=bottom loop preload} \n:::
# Output:
<figure>
    <video controls loop preload><source src="http://techslides.com/demos/sample-videos/small.mp4" type="video/mp4">
    </video>
    <figcaption>My Caption</figcaption>
</figure>
  • With invalid attributes Invalid attributes provided to the attribute list will be simple ignored.

::: video [This is sample video](http://techslides.com/demos/sample-videos/small.mp4){preplay mute} \n:::
`preplay and mute being invalid attribute`

# OUTPUT:
<figure>
    <figcaption>This is sample video</figcaption>
    <video controls ><source src="http://techslides.com/demos/sample-videos/small.mp4" type="video/mp4">
    </video>
</figure>
  • Valid attributes after a set of invalid attributes will be used while templating

::: video [This is sample video](http://techslides.com/demos/sample-videos/small.mp4){muted=3 height=300} \n:::
`muted beign a boolean swtich for video tag, muted=3 makes it an invalid attribute but height is treated as a valid attribute here`

# OUTPUT:
<figure>
    <figcaption>This is sample video</figcaption>
    <video controls height=300 ><source src="http://techslides.com/demos/sample-videos/small.mp4" type="video/mp4">
    </video>
</figure>

11. Subscript

This is not part of commonMark specification and it will result in an inline element.

~This~ should be subscript.

# OUTPUT:
<p>
	<sub>This</sub> should be subscript.
</p>

This should be subscript.

With attributes

~This~{.class-name} should be subscript.

# OUTPUT:
<p>
	<sub class="class-name">This</sub> should be subscript.
</p>

This should be subscript.

12. Superscript

This is not part of commonMark specification and it will result in an inline element.

Without attributes

^This^ should be superscript.

# OUTPUT:
<p>
	<sup>This</sup> should be superscript.
</p>

This should be superscript.

With attributes

^This^{.class-name} should be superscript.

# OUTPUT:
<p>
	<sup class="class-name">This</sup> should be superscript.
</p>

This should be superscript.

13. Span (Attach Attributes To Text)

This is not part of commonMark specification and it will result in an inline element. Opening tag is :span: and closing is :/span:.

This tag is only designed for attaching attributes to text. In any other scenarios, you don’t need this tag. It’s also very limited and has the following side effects/limitations:

  • Doesn’t allow usage of span inside another span.

  • Escapes the markdown content of span and shows the content as is (without rendering markdown). As a result you cannot mix span with other markdown tags.

This :span:text:/span:{.cl-name style="color:red"} has new color.

# OUTPUT:
<p>
	This <span class="cl-name" style="color:red">text</span> has new color.
</p>

This text has new color.

You can also have empty span. You can use this to display icons.

:span::/span:{.fa-solid .fa-download}

# OUTPUT:
<p>
	<span class="fa-solid fa-download"></span>
</p>

14. Escape markdown content

This is not part of commonMark specification and it will result in an inline element. Opening tag is :mdEscape: and closing is :/mdEscape:.

This tag can be used to print the content as is and escape the markdown rendering. For example, if you want to show a JSON column value, by default, the {} will be treated as attributes of markdown, so you would need to escape the content.

:mdEscape:{"first_name": "John", "last_name": "Smith"}:/mdEscape: should be superscript.

# OUTPUT:
<p>
	<span>{"first_name": "John", "last_name": "Smith"}</span>
</p>

{"first_name": "John", "last_name": "Smith"}

The following is how you can add links: :mdEscape:[caption](link):/mdEscape:

# OUTPUT:
<p>
	The following is how you can add links: <span>[caption](link)</span>
</p>

The following is how you can add links: [caption](link)

16. Table

Tables are not part of the commonMark specifications, but the parser that we use follows the GitHub Flavored Markdown specification for tables.

A table is an arrangement of data with rows and columns, consisting of a single header row, a delimiter row separating the header from the data, and zero or more data rows.

Each row consists of cells containing arbitrary text, in which inlines are parsed, separated by pipes (|). A leading and trailing pipe is also recommended for clarity of reading, and if there’s otherwise parsing ambiguity. Spaces between pipes and cell content are trimmed. Block-level elements cannot be inserted in a table.

The delimiter row consists of cells whose only content are hyphens (-), and optionally, a leading or trailing colon (:), or both, to indicate left, right, or center alignment respectively.

For example,

| foo | bar |\n| --- | --- |\n| baz | bim |\n

#OUTPUT
<table>
    <thead>
        <tr>
        <th>foo</th>
        <th>bar</th>
        </tr>
    </thead>
    <tbody>
        <tr>
        <td>baz</td>
        <td>bim</td>
        </tr>
    </tbody>
</table>
foobar
bazbim

The table is broken at the first empty line, or beginning of another block element:

  • Example 1 (table and a header which is block-level)

    | foo | bar |\n| --- | --- |\n| baz | bim |\n #### header
    
    #OUTPUT
    <table>
        <thead>
            <tr>
            <th>foo</th>
            <th>bar</th>
            </tr>
        </thead>
        <tbody>
            <tr>
            <td>baz</td>
            <td>bim</td>
            </tr>
        </tbody>
    </table>
    <h4>header</h4>
    
    foobar
    bazbim

    header

  • A table and a link (an inline element) after it with extra newline in between. If you fail to add the empty newline inbetween, parser will add the link as a new row of the table.

    | foo | bar |\n| --- | --- |\n| baz | bim |\n\n[caption](example.com)
    
    #OUTPUT
    <table>
        <thead>
            <tr>
            <th>foo</th>
            <th>bar</th>
            </tr>
        </thead>
        <tbody>
            <tr>
            <td>baz</td>
            <td>bim</td>
            </tr>
        </tbody>
    </table>
    <a href="example.com">caption</h4>
    
    foobar
    bazbim
    caption

17. Gene Sequence

This is not part of commonMark specification and it will result in a block. You have to follow the syntax completely (notice the newline in the closing tag). The following is the basic syntax structure:

::: geneSequence SEQUENCE {<attribute>=<value>} \n:::

There must be a space before \n:::.

Examples

  • Without any attributes:

    ::: geneSequence MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTK \n:::
    
  • Without any attributes as part of a markdown_pattern (assume sequence column returns the gene sequence string):

    ::: geneSequence {{{_sequence}}} \n:::
    
  • A compact version for compact contexts:

    ::: geneSequence MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTK {.chaise-gene-sequence-compact} \n:::
    
  • A compact version for compact contexts as part of a markdown_pattern (assume sequence column returns the gene sequence string):

    ::: geneSequence {{{_sequence}}} {.chaise-gene-sequence-compact} \n:::
    

18. Div (Custom container)

This is not part of commonMark specification and it will result in a block. The :::div block allows you to create custom <div> containers with attributes and nested content, which is useful for creating complex layouts like Bootstrap cards or custom styled sections.

Basic Syntax

There are two syntax styles:

  1. Single-line syntax (content on the same line as opening tag):

    :::div content here {.class-name} \n:::
    
  2. Multi-line syntax (attributes on opening tag, content on separate lines):

    :::div {.class-name attribute="value"}\ncontent here \n:::
    

Nesting

You can nest divs by using more colons for inner divs or other custom blocks described above:

  • :::div - outer div (3 colons)

  • ::::div - nested div (4 colons)

  • :::::div - deeper nested div (5 colons)

Paragraph Unwrapping

When a div contains only a single element (like an image, heading, or link), the wrapping <p> tag is automatically removed for cleaner HTML structure. This is especially useful for Bootstrap components.

Examples

  • Simple div with class:

    :::div {.container}\nThis is content inside a div.\n:::
    

    Output:

    <div class="container">
      <p>This is content inside a div.</p>
    </div>
    
  • Div with multiple attributes:

    :::div {#my-section .highlight data-value="test"}\nHighlighted content\n:::
    

    Output:

    <div id="my-section" class="highlight" data-value="test">
      <p>Highlighted content</p>
    </div>
    
  • Nested divs:

    :::div {.outer}\n::::div {.inner}\nNested content\n::::\n:::
    

    Output:

    <div class="outer">
      <div class="inner">
        <p>Nested content</p>
      </div>
    </div>
    
  • Div with image (paragraph unwrapped):

    :::div {.image-container}\n![Alt text](https://example.com/image.jpg){.img-fluid}\n:::
    

    Output:

    <div class="image-container">
      <img src="https://example.com/image.jpg" alt="Alt text" class="img-fluid -chaise-post-load">
    </div>
    
  • Bootstrap card example:

    :::div {.card style="width: 18rem;"}\n![Card image](https://example.com/card.jpg){.card-img-top}\n::::div {.card-body}\n#### Card Title {.card-title}\nSome quick example text to build on the card title and make up the bulk of the card's content.\n[Go somewhere](https://example.com){.chaise-btn .chaise-btn-primary}\n::::\n:::
    

    Output:

    <div class="card" style="width: 18rem;">
      <img src="https://example.com/card.jpg" alt="Card image" class="card-img-top -chaise-post-load">
      <div class="card-body">
        <h4 class="card-title">Card Title</h4>
        <p>Some quick example text to build on the card title and make up the bulk of the card's content.</p>
        <a href="https://example.com" class="chaise-btn chaise-btn-primary">Go somewhere</a>
      </div>
    </div>
    

    See how the inner div has four :s.

  • Div containing other custom blocks (iframe):

    :::div {.embed-container}\n:::: iframe [View Map](https://example.com/map){width=800 height=600}\n::::\n:::
    

    The inner blocks must have four :s.

  • Div with multiple elements:

    :::div {.section}\n## Section Title\n\nThis is a paragraph with some text.\n\n- List item 1\n- List item 2\n:::
    

19. File Preview

This is not part of commonMark specification and it will result in a block. You have to follow the syntax completely (notice the newline in the closing tag). The following is the basic syntax structure:

::: filePreview [CAPTION](https://example.com/files/sample.txt){<attribute>=<value>} \n:::

There must be a space before \n:::.

  • CAPTION: Optional plain text caption (no HTML allowed). If provided, it will be displayed as-is.

  • URL: The file URL to preview/download

  • attribute list: Supported attributes:

    • filename: Specify the filename for download

    • class: CSS classes to attach to the preview container

    • preview-type: Specify the type of preview to use. Otherwise the type will be determined by looking at the file content, filename and/or url.

    • prefetch-bytes: Number of bytes to prefetch for preview. Cannot be more than the default value (524288).

    • prefetch-max-file-size: Maximum file size to prefetch. Cannot be more than the default value (1048576).

    • hide-download-btn: Hide the download button (boolean)

    • download-btn-class: CSS classes for the download button

Examples

  • Without any attributes:

    ::: filePreview [](https://example.com/files/sample.txt) \n:::
    
  • With caption:

    ::: filePreview [Click to download the sample data](https://example.com/files/sample.txt) \n:::
    
  • As part of a markdown_pattern (assume file_url column returns the url):

    ::: filePreview []({{{_file_url}}}) \n:::
    
  • With filename attribute:

    ::: filePreview [](https://example.com/files/data.csv){filename="my-data.csv"} \n:::
    
  • With multiple attributes:

    ::: filePreview [Sample File](https://example.com/files/data.txt){filename="data.txt" class="custom-preview" preview-type="text"} \n:::
    
  • Hide download button:

    ::: filePreview [](https://example.com/files/sample.txt){hide-download-btn} \n:::
    
  • With download button styling:

    ::: filePreview [](https://example.com/files/report.pdf){download-btn-class="chaise-btn-primary"} \n:::