# Markdown Formatting Markdown is a plain text format for writing structured documents. We use [markdown-it](https://github.com/markdown-it/markdown-it) to parse markdown content which follows [commonMark specifications](https://spec.commonmark.org/0.30/). For common markdown syntax please refer to [this reference sheet](http://commonmark.org/help/). The following content are mainly focused on more advanced features and/or features specific to ERMrestJS. ## Table of Contents * [Inline Vs. Block](#inline-vs-block) * [Attributes](#attributes) + [Tooltip](#tooltip) + [Classes](#classes) - [Special Classes](#special-classes) * [Examples](#examples) + [1. Link (Anchor)](#1-link-anchor) + [2. Download Button](#2-download-button) + [3. Image](#3-image) - [3.1. Image with static width and height](#31-image-with-static-width-and-height) - [3.2. Image with maximum width and maximum height](#32-image-with-maximum-width-and-maximum-height) - [3.3. Preserving the aspect ratio of image](#33-preserving-the-aspect-ratio-of-image) + [4. Thumbnail With Link To Original Image And A caption](#4-thumbnail-with-link-to-original-image-and-a-caption) + [5. Image with zoom capabilties](#5-image-with-zoom-capabilties) + [6. Iframe](#6-iframe) - [a. Styling the Iframe](#a-styling-the-iframe) - [a.1. Without any attributes](#a1-without-any-attributes) - [a.2. With height and width defined](#a2-with-height-and-width-defined) - [a.3. Invalid link](#a3-invalid-link) - [a.4. Iframe without scrolling](#a4-iframe-without-scrolling) - [a.5. Class and style attached to the iframe element](#a5-class-and-style-attached-to-the-iframe-element) - [a.6. Iframe with figure class and style](#a6-iframe-with-figure-class-and-style) - [a.7. Iframe with caption styles and figure styles](#a7-iframe-with-caption-styles-and-figure-styles) - [b. Captions](#b-captions) - [b.1. Linkable caption](#b1-linkable-caption) - [b.2. Download link caption](#b2-download-link-caption) - [b.3. Caption positioned at the bottom](#b3-caption-positioned-at-the-bottom) - [b.4. Caption class and style](#b4-caption-class-and-style) - [b.5. Linkable caption open new tab](#b5-linkable-caption-open-new-tab) - [c. Responsiveness and Other Cases](#c-responsiveness-and-other-cases) - [c.1. Stretch to height and width of parent container](#c1-stretch-to-height-and-width-of-parent-container) - [c.2. Fill container with min-width](#c2-fill-container-with-min-width) - [c.3. Fill container with min-width and min-height and max-height](#c3-fill-container-with-min-width-and-min-height-and-max-height) - [c.4. Iframe with set height and responsive width](#c4-iframe-with-set-height-and-responsive-width) - [c.5. Iframe with variable height based on viewport with bounds](#c5-Iframe-with-variable-height-based-on-viewport-with-bounds) - [c.6. Iframe with fullscreen button hidden](#c6-iframe-with-fullscreen-button-hidden) - [c.7. Iframe with fullscreen button open new tab](#c7-iframe-with-fullscreen-button-open-new-tab) + [7. Dropdown download button](#7-dropdown-download-button) + [8. Vocabulary](#8-vocabulary) + [9. Youtube Video](#9-youtube-video) + [10. Video](#10-video) + [11. Subscript](#11-subscript) + [12. Superscript](#12-superscript) + [13. Span (Attach Attributes To Text)](#13-span-attach-attributes-to-text) + [14. Escape markdown content](#14-escape-markdown-content) + [15. RID link](#15-rid-link) + [16. Table](#15-table) + [Gene Sequence](#17-gene-sequence) ## Inline Vs. Block In HTML we have block and inline elements. Block elements usually add a newline and extra spaces around the content, while inline elements will only take up as much width as is needed to display the content. Paragraphs `

`, headers ``, and division `

` are some of the common block elements. Span ``, images ``, and anchors `` are examples for inline blocks. This concept exists in ERMrestJS markdown parser too. If we parse the content as a block, if the given markdown value does not produce a proper block element, it will be wrapped in a `

` tag. While rendering it inline, will not add the `

` tag. Also newline (`\n`) is not acceptable in values of inline elements. ```html [caption](http://example.com) #inline output caption #block output

caption

``` Therefore sometimes we prefer to render the value as inline. ERMrestJS parser also has different set of rules for inline and block. All the inline tags are acceptable while rendering a block, but not the other way around. For example you cannot have a header in inline. So you need to be careful while using the blocks. The following are different places that we are rendering inline. Other parts of code accept block elements. - row-name logic. More specifcally the logic for processing `row_markdown_pattern`. - While processing `markdown_name` (used on facets, columns, tables, and schemas). ## Attributes You can attach attributes to any element in your markdown. Generally you can attach the attributes in `{}` to your element. For example if you want to add attributes to a link, you can use the `[caption](link){attributes}` template. You can have any number of attributes and to separate the attributes you just need to have white space between them. The following are some examples of attaching attributes: - Attaching multiple attributes: ```html **Multiple attributes Example**{.test .cls-2 val=1 disabled} #OUTPUT

Multiple attributes Example

``` >

Multiple attributes Example

- Attaching attributes to markdown table (the two newlines between the end of table and the added attributes are required): ```html |header|\n|-|\n|text|\n\n{.class-name} #OUTPUT
heading
text
``` >
heading
text
Depending on the markdown element type, different attrbiutes will be acceptable and throughout this document we will mention them. The following are some of the general attributes: ### Tooltip Using `data-chaise-tooltip` attribute you can add a tooltip to any HTML element. ``` [tooltip example](http://example.com){data-chaise-tooltip="tooltip for this link"} ``` By default the tooltip will be displayed at the bottom of the element. We're also showing the tooltip icon beside the element. If you don't want this behavior the following is ways to customize this: 1. You can use the `data-chaise-tooltip-placement` to change this placement. Accepted values are `"top"`, `"right"`, `"bottom"`, `"left"`. For example, ``` :span:Caption:/span:{data-chaise-tooltip="tooltip for this link" data-chaise-tooltip-placement="right"} ``` 2. By adding `data-chaise-tooltip-no-icon` to your definition we're not going to add the tooltip icon. ``` :span:Caption:/span:{data-chaise-tooltip="tooltip for this link" data-chaise-tooltip-no-icon} ``` ### Classes Any attribute that starts with a `.` will be treated as class name. ```html [class example](http://example.com){.test} #OUTPUT

class example

``` >

class example

#### Special Classes The following is the list of special class names that you can use: - `.chaise-btn`: This class is used to represent buttons. You should use it in conjunction with any of the following classes: - `.chaise-btn-primary` - `.chaise-btn-secondary` - `.chaise-btn-tertiary` - `.download-alt`: Used to represent a download button. `.download` is the old and alternative class for it. - `.asset-permission`: If used on a link element, chaise will validate whether the user can download the asset before a download is attempted. - `.external-link`: By adding this to links, chaise shows a notification to the user when they are being navigated away from chaise for external links and assets hosted elsewhere. - `.external-link-no-icon`: By default we're going to add a icon to any external links. If you don't want it in a particular link, you can use this class. - `.vocab`: Used to represent a vocabulary. - `.chaise-autofill`: Used to set the height and width to fill the parent container based on the user's browser. - `.fullscreen-off`: When applied in iframe template, this class hides the full screen button that appears at the top right corner. - `.chaise-reduce-header-margin`: Used on a `

` or other header tag to reduce the space after the header to 5px. [Link to implementation](https://github.com/informatics-isi-edu/chaise/blob/master/src/assets/scss/_markdown-container.scss#L107-L109) - `.chaise-iframe-after`: Reduces the margin after the element's content when an iframe is the next element. This class will reduce the margin and pull the iframe content closer. [Link to implementation](https://github.com/informatics-isi-edu/chaise/blob/master/src/assets/scss/_markdown-container.scss#L112-L114) - `.chaise-image-preview`: When applied to an image, Chaise will properly display a scaled down version of the image to the users. Clicking on the image would allow users to see the fully scaled version of the image. You can find an example [here](#6-image-with-zoom-capabilties). While the behavior looks like a zoom, by clicking on images with this class, we're switching between these two modes: - The scaled-down version, - The height of the image is limited to 50vh. Therefore small images will be displayed fully, while the bigger images will be scaled down to fit the limited size. - The width is limited to the available width space on the page. - The browser will fit the image in the limited height/width while keeping the image's aspect ratio. Hence, in an image with a larger height than width, you will see extra white space to the left and right of the image. - The zoomed-in version, - The height and width of the image are not limited; instead, the limits mentioned above are moved to the image's container. That's why we will see scrollbars in larger images, and in smaller images, nothing will change. > The max height mentioned above can be changed by defining the `image-preview-max-height` property. Please refer to the example for more information. - content classes for positioning: - classes for horizontal alignment: - `.chaise-content-left`: Aligns the inner content to the left side of the container this class is attached to - `.chaise-content-center`: Aligns the inner content to the center of the container this class is attached to - `.chaise-content-right`: Aligns the inner content to the right side of the container this class is attached to - classes for vertical alignment: - `.chaise-content-top`: Aligns the inner content to the top of the container this class is attached to - `.chaise-content-middle`: Aligns the inner content to the middle of the container this class is attached to - `.chaise-content-bottom`: Aligns the inner content to the bottom of the container this class is attached to - `.chaise-word-break-all`: This enforces the given content to be broken at any character if it's overflowing. Useful for long an arbitary content. - For example you can add this to the asset presentation to ensure better UI in `compact` contexts: `[{{{filename}}}]({{{url}}}){download .chaise-word-break-all}`. Make sure to also add a `min-width` to the column header, otherwise the column might become very narrow. - `.chaise-gene-sequence-compact`: When applied to a [Gene Sequence](#17-gene-sequence) block, it will ensure showing a more compact version. This is recommended for `compact` contexts. ## Examples ### 1. Link (Anchor) This is part of commonMark specification. Links are [inline](#inline-vs.-block) elements. ```html [ChaiseLink](https://example.com/chaise/search) #OUTPUT:

ChaiseLink

``` >

ChaiseLink

You can attach attributes to the link. ```html [ChaiseLink](https://example.com/chaise/search){target=_blank} # OUTPUT:

ChaiseLink

``` >

ChaiseLink

### 2. Download Button Download button is a link with some predefined attributes. You can use these attributes to ensure consistent display for the download buttons: - `download` will trigger the browser's default download behavior and displays the links like the following: ![download default UI](https://raw.githubusercontent.com/informatics-isi-edu/ermrestjs/master/docs/resources/download-alt-btn.png) - `.download-alt` will change the link to look like the following: ![alternative download UI](https://raw.githubusercontent.com/informatics-isi-edu/ermrestjs/master/docs/resources/download-btn.png) - If you would like to create your own download button, we suggest adding a class attribute here and using this class for definining your own CSS rules. - Chaise is defining rules based on `a[download]` selector. You need to ensure that the default CSS rules are overriden and the new ones are added. - `.asset-permission` can be added to validate whether the user can download the asset before a download is attempted. - `.external-link` can be added to show a notification to the user when they are being navigated away from chaise for external links and assets hosted elsewhere. - `.chaise-word-break-all` can be added to download buttons that have a very long filename in `compact` contexts. It will force the content to be broken into multiple lines. Make sure to also add a `min-width` to the column header, otherwise the column might become very narrow. Example: ```html [Filename](https://code.jquery.com/jquery-3.1.0.js){download .download-alt .asset-permission} # OUTPUT:

Jquery Download

``` **NOTE:** please stick to the above formats only to generate a download link. ### 3. Image By adding `!` at the begining of a link definition, it will display the image. Images are [inline](#inline-vs.-block) elements. ```html ![Image](http://assets.barcroftmedia.com.s3-website-eu-west-1.amazonaws.com/assets/images/recent-images-11.jpg) # OUTPUT:

Image

``` >

Image

Just like any other elements, you can define attributes for the Images by defining them in a block after the tag: ``` ![alt text](IMAGE_URL){ = } ``` The following are the most common attributes that you could use: - `width` and `height`: Useful when you know the width and height of the image, or want to limit the image to certain size. - `style`: Can be used for specifying any styles on the image. The following are some common examples of styling Images: #### 3.1. Image with static width and height You can define the `width` and `height` attributes for an image. ```html ![ImageWithSize](http://assets.barcroftmedia.com.s3-website-eu-west-1.amazonaws.com/assets/images/recent-images-11.jpg){width=800 height=300} # OUTPUT:

ImageWithSize

``` >

ImageWithSize

#### 3.2. Image with maximum width and maximum height Instead of defining static with and height, you can also define maximum allowed values: ```html ![ImageWithSize](http://assets.barcroftmedia.com.s3-website-eu-west-1.amazonaws.com/assets/images/recent-images-11.jpg){width=500 style="max-height:300px;max-width:800px;"} # OUTPUT:

ImageWithSize

``` >

ImageWithSize

#### 3.3. Preserving the aspect ratio of image To preserve the image's aspect ratio, you need to add the `object-fit:contain` style. This is style is helpful in combination with static `width` or `height`. For example, ``` ![](https://example.com/path/to/image.png){style=height:500px;object-fit:contain} ``` With this, the image's height would be 500px, and `object-fit:contain` will signal the browser to choose a proper width based on the available space and the image's aspect ratio. You can also use this style with both width and height: ``` ![](https://example.com/path/to/image.png){style=height:500px;width:500px;object-fit:contain} ``` This example specifies the width and height of the image's container. And depending on the aspect ratio of the image, you will see white space around the scaled-down image (instead of stretching the image to the container's width/height). ### 4. Thumbnail With Link To Original Image And A caption This is not part of commonMark specification and it will result in a [block](#inline-vs-block). You have to follow the syntax completely (notice the newline in the closing tag). With attributes width=500, height=400 and a linkable caption to open it in new tab(All of them are optional) ```html :::image [caption](thumbnail-URL){width=500 height=400 link="destination-URL"} \n::: :::image [Skyscrapers](http://assets.barcroftmedia.com.s3-website-eu-west-1.amazonaws.com/assets/images/recent-images-11.jpg){width=500 height=400 link="https://static.pexels.com/photos/2324/skyline-buildings-new-york-skyscrapers.jpg"} \n::: # OUTPUT:
Skyscrapers
``` >
Skyscrapers
### 5. Image with zoom capabilties This is not part of commonMark specification and it will result in a [block](#inline-vs-block). You have to follow the syntax completely (notice the newline in the closing tag). To add zoom capabilities, you just need to add the `figure-class=chaise-image-preview` attribute: ```html :::image [](Image-URL){figure-class=chaise-image-preview} \n::: :::image [](https://example.com/path/to/image.png){figure-class=chaise-image-preview} \n::: ``` You could customize the maximum height that we should use by defining the `image-preview-max-height` property like the following: ```html :::image [](https://example.com/path/to/image.png){figure-class=chaise-image-preview image-preview-max-height="300px"} \n::: ``` If you're using this feature in a tabular view, you need to specify the width of the container. Otherwise clicking on the image will expand the image beyond the table's allowed width. For example: ```html :::image [](https://example.com/path/to/image.png){figure-class=chaise-image-preview image-preview-max-height="300px" figure-style=width:300px } \n::: ``` ### 6. Iframe This is not part of commonMark specification and it will result in a [block](#inline-vs-block). You have to follow the syntax completely (notice the newline in the closing tag). The following is the basic syntax structure: ```mkdn ::: iframe [CAPTION](https://example.com) {=} \n::: ``` Below are examples of how to apply height, width, style, and class to the iframe and caption. #### a. Styling the Iframe The following list of terms are used to describe how to style iframes: - `height` and `width` - used to specify iframe width and iframe height - `style` - the attribute used to attach any standard CSS properties directly to the iframe - more commonly used CSS properties for iframes include `min-height`, `min-width`, `max-height`, and `max-width` - `class` - the attribute used to attach a class to the iframe - any self defined class or classes defined as part of chaise are allowed - the `chaise-autofill` class will set the appropriate values for height and width based on the user's browser - CAUTION: using `chaise-autofill` will ignore the set `height` or `width` - the `fullscreen-off` class will hide the fullscreen button - NOTE: see example below on how to use this #### a.1. Without any attributes ```html ::: iframe [CAPTION](https://example.com) \n::: # OUTPUT:
CAPTION
``` #### a.2. With height and width defined ```html ::: iframe [CAPTION](https://example.com){width="800" height="300"} \n::: # OUTPUT:
CAPTION
``` #### a.3. Invalid link If you provide an invalid link then instead of an iframe you will just get the internal markdown rendered ```html :::iframe *Invalid [CAPTION](https://example.com) \n::: # OUTPUT:

Invalid CAPTION

``` >

Invalid CAPTION

#### a.4. Iframe without scrolling ```html ::: iframe [CAPTION](https://example.com){width="800" height="300" scrolling="no"} \n::: # OUTPUT:
CAPTION
``` #### a.5. Class and style attached to the iframe element ```html ::: iframe [CAPTION](https://example.com){pos="bottom" style="border: 5px solid;" class="iframe-element-class"} \n::: # OUTPUT:
CAPTION
``` #### a.6. Iframe with figure class and style To style the whole iframe enclosing block (`
`) you can either specify classes using `figure-class` or CSS style using `figure-style`. - NOTE: `iframe-class` and `iframe-style` are deprecated. ```html ::: iframe [CAPTION](https://example.com){pos="bottom" figure-class="iclass" figure-style="border: 1px solid;" link="https://example.com} \n::: # OUTPUT:
CAPTION
``` #### a.7. Iframe with caption styles and figure styles ```html ::: iframe [CAPTION](https://example.com){pos="bottom" figure-class="iclass" figure-style="border: 1px solid;" caption-class="cclass" caption-style="font-weight: 500;" link="https://example.com} \n::: # OUTPUT:
CAPTION
``` #### b. Captions #### b.1. Linkable caption ```html ::: iframe [CAPTION](https://example.com){width="800" height="300" caption-link="https://example.com"} \n::: # OUTPUT:
``` #### b.2. Download link caption ```html ::: iframe [CAPTION](https://example.com){width="800" height="300" caption-link="https://example.com" caption-link-attrs=download } \n::: # OUTPUT:
``` #### b.3. Caption positioned at the bottom ```html ::: iframe [CAPTION](https://example.com){width="800" height="300" caption-link="https://example.com" pos="bottom" } \n::: # OUTPUT:
CAPTION
``` #### b.4. Caption class and style To style the caption of an iframe you can either specify classes using `caption-class` or CSS style using `caption-style`. ```html ::: iframe [CAPTION](https://example.com){pos="bottom" caption-class="cclass" caption-style="font-weight: 500;" caption-link="https://example.com} \n::: # OUTPUT:
CAPTION
``` #### b.5. Linkable caption open new tab To have the caption open in a new tab, use `caption-target=_blank`. ```html ::: iframe [CAPTION](https://example.com){width="800" height="300" caption-link="https://example.com" caption-target="_blank"} \n::: # OUTPUT:
``` #### c. Responsiveness and Other Cases Some best practices for creating responsive or specifically sized iframes are as follows: - For fixed iframe dimensions use `height` and `width`. - Responsive iframe dimensions: - To expand the iframe width to browser width, attach the `chaise-autofill` class and define `min-width` on the iframe as part of the `style`. - If browser width is less than the cell's width (or max width), a scrollbar will be present in the cell itself to scroll left/right to see the rest of the content. - To expand the iframe height to the cell height, attach the `chaise-autofill` class. - Specify `min-height` to initialize the iframe height with the min height value without removing the responsiveness from `chaise-autofill` - Defining `max-height` on the iframe will limit the responsiveness from continually stretching the iframe - Other cases: - For iframes that are accompanied by a potentially long caption, define `min-height` on the iframe to ensure the cell resizes to fit all of the caption and the iframe. - CSS styles can be applied to the `` element with `id="entity-"` to set height/width for the cell #### c.1. Stretch to height and width of parent container If parent container (cell in record app) has no styles, the iframe will only fill the minimum height of the cell ```html ::: iframe [CAPTION](https://example.com){class=chaise-autofill} \n::: # OUTPUT:
CAPTION
``` #### c.2. Fill container with min-width When a min-width value is defined, the parent container will stop resizing once the viewport width forces the container to be smaller than the iframe. ```html ::: iframe [CAPTION](https://example.com){class=chaise-autofill style="min-width: 500px;"} \n::: # OUTPUT:
CAPTION
``` #### c.3. Fill container with min-width and min-height and max-height When a min-height value is defined, the parent container will resize to allow for the defined minimum height. Max height is defined to limit the iframe from continually stretching as noted in the best practices above. ```html ::: iframe [CAPTION](https://example.com){class=chaise-autofill style="min-width: 500px; min-height: 400px; max-height: 800px;"} \n::: # OUTPUT:
CAPTION
``` #### c.4. Iframe with set height and responsive width To have a responsive width and a set height, do not use `chaise-autofill` and set `height` or `min-height` with `width: 100%`. ```html ::: iframe [CAPTION](https://example.com){width=100% style="min-width: 300px; min-height: 400px;"} \n::: # OUTPUT:
CAPTION
``` #### c.5. Iframe with variable height based on viewport with bounds To create an iframe that responds to the current viewport size, set the height using `vh` units. ```html ::: iframe [CAPTION](https://example.com){style="min-height: 400px; height: 75vh; max-height: 900px;"} \n::: # OUTPUT:
CAPTION
``` #### c.6. Iframe with fullscreen button hidden To hide the fullscreen button, use the `fullscreen-off` class attached to the figure. ```html ::: iframe [CAPTION](https://example.com){width=100% class="chaise-autofill" figure-class="fullscreen-off"} \n::: # OUTPUT:
CAPTION
``` #### c.7. Iframe with fullscreen button open new tab To have the fullscreen button open in a new tab, use `fullscreen-target=_blank`. ```html ::: iframe [CAPTION](https://example.com){width=100% class="chaise-autofill" fullscreen-target="_blank"} \n::: # OUTPUT:
CAPTION
``` ### 7. Dropdown download button This is not part of commonMark specification and it will result in a [block](#inline-vs-block). You have to follow the syntax completely (notice the newline in the closing tag). ```sh # :::dropdown CPATION [LINKCAPTION1](URL1){download} [LINKCAPTION2](URL2){download} ::: dropdown DROPDOWNCAPTION [CAPTION1](https://example.com/chaise/search){download} [CAPTION2](https://example.com/chaise/search){download} \n::: # OUTPUT:
``` The button has an appearance similar to the [Bootstrap dropdown button](http://getbootstrap.com/components/#btn-dropdowns-split) You can test the `markdown_pattern` string [here](https://tonicdev.com/chiragsanghvi/57b4b5f94c7bbd13004b43f6). Just scroll down and change the `markdown_pattern` string and `obj` object according to your requirement. ### 8. Vocabulary To show text as vocabulary, you can use the predefined `vocab` class. The following markdown pattern turns a bock of text, to a gray bold bubble with color blue. ```sh **some bold term**{.vocab} # OUTPUT: some bold term ``` ### 9. Youtube Video Assuming that `https://www.youtube.com/watch?v=YOUTUBE_VIDEO_ID` is the link to a youtube video, - Video thumbnail is `https://img.youtube.com/vi/YOUTUBE_VIDEO_ID/0.jpg` - Embed link is `https://www.youtube.com/embed/YOUTUBE_VIDEO_ID`. You can also pass different query parameters to customize the way the video looks like. Please refer to the [Youtube API document](https://developers.google.com/youtube/player_parameters) for more information. Therefore you have two options for showing a youtube video in your markdown templates: - Use an iframe ```html ::: iframe [Video Caption](https://www.youtube.com/embed/YOUTUBE_VIDEO_ID){width=800 height=300} \n::: # OUTPUT:
CAPTION
``` - Show the video thumbnail that is linked to the youtube video ```html [![](https://img.youtube.com/vi/YOUTUBE_VIDEO_ID/0.jpg){width=800 height=300}](https://www.youtube.com/watch?v=YOUTUBE_VIDEO_ID) # OUTPUT:

``` ### 10. Video This is not part of commonMark specification and it will result in a [block](#inline-vs-block). You have to follow the syntax completely (notice the newline in the closing tag). ``` markdown syntax: '::: video []()[{attribute list}] \n:::' ``` **There must be a space before `\n:::`**. - **caption**: The caption provides a short description of the video - **source**: The address to the location of the video - **attribute list:** The attributes supported will be (height, width, preload, loop, muted, autoload, pos) - height: Sets the height of the video player - width: Sets the width of the video player - preload: Specifies if and how the author thinks the video should be loaded when the page loads - loop: Specifies that the video will start over again, every time it is finished - muted: Specifies that the audio output of the video should be muted - pos: Specifies where the caption of video should appear (`top` or `bottom`) **Examples** - Without any attributes ```html ::: video [This is sample video](http://techslides.com/demos/sample-videos/small.mp4)\n::: # OUTPUT:
This is sample video
``` - With attributes width=400, height=300 ```html ::: video [This is sample video](http://techslides.com/demos/sample-videos/small.mp4){width=400 height 300} \n::: # OUTPUT:
This is sample video
" ``` - With boolean attributes muted, autoload, loop, preload ```html ::: video [This is sample video](http://techslides.com/demos/sample-videos/small.mp4){autoload muted loop preload} \n::: # OUTPUT:
This is sample video
``` - To put the video caption at bottom or top, use the `pos` attribute (bootom or top) ```html ::: video [My Caption](http://techslides.com/demos/sample-videos/small.mp4){pos=bottom loop preload} \n::: # Output:
My Caption
``` - With invalid attributes Invalid attributes provided to the attribute list will be simple ignored. ```html ::: video [This is sample video](http://techslides.com/demos/sample-videos/small.mp4){preplay mute} \n::: `preplay and mute being invalid attribute` # OUTPUT:
This is sample video
``` - Valid attributes after a set of invalid attributes will be used while templating ```html ::: video [This is sample video](http://techslides.com/demos/sample-videos/small.mp4){muted=3 height=300} \n::: `muted beign a boolean swtich for video tag, muted=3 makes it an invalid attribute but height is treated as a valid attribute here` # OUTPUT:
This is sample video
``` ### 11. Subscript This is not part of commonMark specification and it will result in an [inline](#inline-vs-block) element. ```html ~This~ should be subscript. # OUTPUT:

This should be subscript.

``` >

This should be subscript.

With attributes ```html ~This~{.class-name} should be subscript. # OUTPUT:

This should be subscript.

``` >

This should be subscript.

### 12. Superscript This is not part of commonMark specification and it will result in an [inline](#inline-vs-block) element. Without attributes ```html ^This^ should be superscript. # OUTPUT:

This should be superscript.

``` >

This should be superscript.

With attributes ```html ^This^{.class-name} should be superscript. # OUTPUT:

This should be superscript.

``` >

This should be superscript.

### 13. Span (Attach Attributes To Text) This is not part of commonMark specification and it will result in an [inline](#inline-vs-block) element. Opening tag is `:span:` and closing is `:/span:`. This tag is only designed for attaching attributes to text. In any other scenarios, you don't need this tag. It's also very limited and has the following side effects/limitations: - Doesn't allow usage of span inside another span. - Escapes the markdown content of span and shows the content as is (without rendering markdown). As a result you cannot mix span with other markdown tags. ```html This :span:text:/span:{.cl-name style="color:red"} has new color. # OUTPUT:

This text has new color.

``` >This text has new color.

You can also have empty span. You can use this to display icons. ```html :span::/span:{.fa-solid .fa-download} # OUTPUT:

``` >

### 14. Escape markdown content This is not part of commonMark specification and it will result in an [inline](#inline-vs-block) element. Opening tag is `:mdEscape:` and closing is `:/mdEscape:`. This tag can be used to print the content as is and escape the markdown rendering. For example, if you want to show a JSON column value, by default, the `{}` will be treated as attributes of markdown, so you would need to escape the content. ```html :mdEscape:{"first_name": "John", "last_name": "Smith"}:/mdEscape: should be superscript. # OUTPUT:

{"first_name": "John", "last_name": "Smith"}

``` >

{"first_name": "John", "last_name": "Smith"}

```html The following is how you can add links: :mdEscape:[caption](link):/mdEscape: # OUTPUT:

The following is how you can add links: [caption](link)

``` > The following is how you can add links: \[caption](link) ### 15. RID link Takes an RID of an existing record and generates a resolvable link for that record. This is not part of commonMark specification. It will result in an [inline](#inline-vs-block) element. You have to follow the syntax completely. ```md [[]] ``` - **RID**: A valid RID to an existing record **Example** ```html [[1-3X0H]] # OUTPUT: 1-3X0H ``` > 1-3X0H ### 16. Table Tables are not part of the commonMark specifications, but the parser that we use follows the [GitHub Flavored Markdown specification for tables](https://github.github.com/gfm/#tables-extension-). A table is an arrangement of data with rows and columns, consisting of a single header row, a delimiter row separating the header from the data, and zero or more data rows. Each row consists of cells containing arbitrary text, in which inlines are parsed, separated by pipes (`|`). A leading and trailing pipe is also recommended for clarity of reading, and if there’s otherwise parsing ambiguity. Spaces between pipes and cell content are trimmed. Block-level elements cannot be inserted in a table. The delimiter row consists of cells whose only content are hyphens (`-`), and optionally, a leading or trailing colon (`:`), or both, to indicate left, right, or center alignment respectively. For example, ```html | foo | bar |\n| --- | --- |\n| baz | bim |\n #OUTPUT
foo bar
baz bim
``` >
foobar
bazbim
The table is broken at the first empty line, or beginning of another block element: - Example 1 (table and a header which is block-level) ``` | foo | bar |\n| --- | --- |\n| baz | bim |\n #### header #OUTPUT
foo bar
baz bim

header

``` >
foobar
bazbim

header

- A table and a link (an inline element) after it with extra newline in between. If you fail to add the empty newline inbetween, parser will add the link as a new row of the table. ``` | foo | bar |\n| --- | --- |\n| baz | bim |\n\n[caption](example.com) #OUTPUT
foo bar
baz bim
caption

``` >
foobar
bazbim
caption ### 17. Gene Sequence This is not part of commonMark specification and it will result in a [block](#inline-vs-block). You have to follow the syntax completely (notice the newline in the closing tag). The following is the basic syntax structure: ```mkdn ::: geneSequence SEQUENCE {=} \n::: ``` **There must be a space before `\n:::`**. **Examples** - Without any attributes: ``` ::: geneSequence MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTK \n::: ``` - Without any attributes as part of a `markdown_pattern` (assume `sequence` column returns the gene sequence string): ``` ::: geneSequence {{{_sequence}}} \n::: ``` - A compact version for `compact` contexts: ``` ::: geneSequence MPVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTK {.chaise-gene-sequence-compact} \n::: ``` - A compact version for `compact` contexts as part of a `markdown_pattern` (assume `sequence` column returns the gene sequence string): ``` ::: geneSequence {{{_sequence}}} {.chaise-gene-sequence-compact} \n::: ```